Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD28 monoclonal antibody (M02), clone 1H3

  • Catalog # : H00000940-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CD28.
  • Immunogen:
  • CD28 (NP_006130.1, 18 a.a. ~ 152 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000940-M02
    Western Blot detection against Immunogen (17.05 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 940
  • Gene Name:
  • CD28
  • Gene Alias:
  • MGC138290,Tp44
  • Gene Description:
  • CD28 molecule
  • Gene Summary:
  • CD28 costimulation is essential for CD4 (MIM 186940)-positive T-cell proliferation, survival, interleukin-2 (IL2; MIM 147680) production, and T-helper type-2 (Th2) development.[supplied by OMIM
  • Other Designations:
  • CD28 antigen,CD28 antigen (Tp44),T-cell-specific surface glycoprotein
  • RSS
  • YouTube
  • Linkedin
  • Facebook