Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MS4A3 (Human) Recombinant Protein (P01)

  • Catalog # : H00000932-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MS4A3 full-length ORF ( AAH08487, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MASHEVDNAELGSASARGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 49.28
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000932-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 932
  • Gene Name:
  • MS4A3
  • Gene Alias:
  • CD20L,HTM4
  • Gene Description:
  • membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific)
  • Gene Summary:
  • This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq
  • Other Designations:
  • CD20 antigen homolog,CD20 antigen-like,IgE receptor beta chain,IgE receptor beta subunit,hematopoietic cell 4 transmembrane protein,membrane-spanning 4-domains subfamily A member 3,membrane-spanning 4-domains, subfamily A, member 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook