MS4A1 monoclonal antibody (M01), clone 5C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MS4A1 monoclonal antibody (M01), clone 5C11 Western Blot analysis of MS4A1 expression in Hela S3 NE ( Cat # L013V3 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MS4A1 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MS4A1.
Immunogen
MS4A1 (AAH02807, 210 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MS4A1 monoclonal antibody (M01), clone 5C11 Western Blot analysis of MS4A1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MS4A1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — MS4A1
Entrez GeneID
931GeneBank Accession#
BC002807Protein Accession#
AAH02807Gene Name
MS4A1
Gene Alias
B1, Bp35, CD20, LEU-16, MGC3969, MS4A2, S7
Gene Description
membrane-spanning 4-domains, subfamily A, member 1
Omim ID
112210Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. [provided by RefSeq
Other Designations
B-lymphocyte cell-surface antigen B1|CD20 antigen|CD20 receptor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com