Product Browser

Last updated: 2020/11/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD19 monoclonal antibody (M04), clone 1E8 

  • Catalog # : H00000930-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against human CD19.
  • Immunogen:
  • A synthetic peptide corresponding to human CD19
  • Sequence:
  • CGPSSPSGKLMSPKLYVWAKDRPEIWEGEPP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (58%); Rat (58%)
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 930
  • Gene Name:
  • CD19
  • Gene Alias:
  • B4,MGC12802
  • Gene Description:
  • CD19 molecule
  • Gene Summary:
  • Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. This gene encodes a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. [provided by RefSeq
  • Other Designations:
  • B-lymphocyte antigen CD19,CD19 antigen
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook