Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CD9 DNAxPab DNAxPab

  • Catalog # : H00000928-W02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a partial-length human CD9 DNA using DNAx™ Immune technology.
  • Immunogen:
  • CD9 (AAH11988, 112 a.a. ~ 195 a.a) partial-length human DNA
  • Sequence:
  • SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (77); Rat (85)
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CD9 expression in transfected 293T cell line by CD9 DNAxPab polyclonal antibody.

    Lane 1: CD9 transfected lysate(30.36 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Entrez GeneID:
  • 928
  • Gene Name:
  • CD9
  • Gene Alias:
  • 5H9,BA2,BTCC-1,DRAP-27,GIG2,MIC3,MRP-1,P24,TSPAN29
  • Gene Description:
  • CD9 molecule
  • Gene Summary:
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It can modulate cell adhesion and migration and also trigger platelet activation and aggregation. In addition, the protein appears to promote muscle cell fusion and support myotube maintenance. [provided by RefSeq
  • Other Designations:
  • 5H9 antigen,CD9 antigen,CD9 antigen (p24),OTTHUMP00000041574,OTTHUMP00000041576,antigen defined by monoclonal antibody 602-29,growth-inhibiting gene 2 protein,leukocyte antigen MIC3,motility related protein,motility related protein-1,p24 antigen
  • RSS
  • YouTube
  • Linkedin
  • Facebook