Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD8B1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000926-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD8B1 partial ORF ( NP_004922, 23 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000926-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 926
  • Gene Name:
  • CD8B
  • Gene Alias:
  • CD8B1,LYT3,Leu2,Ly3,MGC119115
  • Gene Description:
  • CD8b molecule
  • Gene Summary:
  • The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. [provided by RefSeq
  • Other Designations:
  • CD8 antigen, beta polypeptide (p37),CD8 antigen, beta polypeptide 1 (p37),CD8b antigen,OTTHUMP00000160761,T lymphocyte surface glycoprotein beta chain,T-cell surface glycoprotein CD8 beta chain
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook