CD8A monoclonal antibody (M10), clone 4B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunoprecipitation
Immunoprecipitation of CD8A transfected lysate using anti-CD8A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD8A MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD8A is approximately 3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CD8A on HeLa cell . [antibody concentration 40 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CD8A.
Immunogen
CD8A (AAH25715, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunoprecipitation
Immunoprecipitation of CD8A transfected lysate using anti-CD8A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD8A MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD8A is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CD8A on HeLa cell . [antibody concentration 40 ug/ml] -
Gene Info — CD8A
Entrez GeneID
925GeneBank Accession#
BC025715Protein Accession#
AAH25715Gene Name
CD8A
Gene Alias
CD8, Leu2, MAL, p32
Gene Description
CD8a molecule
Gene Ontology
HyperlinkGene Summary
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a corepressor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains, or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain isoforms. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CD8 antigen alpha polypeptide|CD8 antigen, alpha polypeptide (p32)|Leu2 T-lymphocyte antigen|OKT8 T-cell antigen|T cell co-receptor|T-cell antigen Leu2|T-cell surface glycoprotein CD8 alpha chain|T-lymphocyte differentiation antigen T8/Leu-2|T8 T-cell ant
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com