Product Browser

Last updated: 2017/6/18
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD247 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000919-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CD247 protein.
  • Immunogen:
  • CD247 (NP_932170.1, 1 a.a. ~ 164 a.a) full-length human protein.
  • Sequence:
  • MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse brain.
  • PDF DownloadProtocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in rat brain.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in IMR-32.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CD247 expression in transfected 293T cell line (H00000919-T01) by CD247 MaxPab polyclonal antibody.

    Lane 1: CD247 transfected lysate(18.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 919
  • Gene Name:
  • CD247
  • Gene Alias:
  • CD3-ZETA,CD3H,CD3Q,CD3Z,T3Z,TCRZ
  • Gene Description:
  • CD247 molecule
  • Gene Summary:
  • The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CD247 antigen, zeta subunit,CD3Z antigen, zeta polypeptide (TiT3 complex),OTTHUMP00000032544,T-cell antigen receptor complex, zeta subunit of CD3,T-cell receptor T3 zeta chain,T-cell receptor zeta chain,T-cell surface glycoprotein CD3 zeta chain
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook