CD247 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse brain.
Western Blot (Tissue lysate)
CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse kidney.
Western Blot (Tissue lysate)
CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in rat brain.
Western Blot (Cell lysate)
CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in Raw 264.7.
Western Blot (Cell lysate)
CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in IMR-32.
Western Blot (Transfected lysate)
Western Blot analysis of CD247 expression in transfected 293T cell line (H00000919-T01) by CD247 MaxPab polyclonal antibody.
Lane 1: CD247 transfected lysate(18.70 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CD247 protein.
Immunogen
CD247 (NP_932170.1, 1 a.a. ~ 164 a.a) full-length human protein.
Sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Host
Rabbit
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (81); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse brain.Western Blot (Tissue lysate)
CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse kidney.Western Blot (Tissue lysate)
CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in rat brain.Western Blot (Cell lysate)
CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in Raw 264.7.Western Blot (Cell lysate)
CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in IMR-32.Western Blot (Transfected lysate)
Western Blot analysis of CD247 expression in transfected 293T cell line (H00000919-T01) by CD247 MaxPab polyclonal antibody.
Lane 1: CD247 transfected lysate(18.70 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — CD247
Entrez GeneID
919GeneBank Accession#
NM_198053Protein Accession#
NP_932170.1Gene Name
CD247
Gene Alias
CD3-ZETA, CD3H, CD3Q, CD3Z, T3Z, TCRZ
Gene Description
CD247 molecule
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
CD247 antigen, zeta subunit|CD3Z antigen, zeta polypeptide (TiT3 complex)|OTTHUMP00000032544|T-cell antigen receptor complex, zeta subunit of CD3|T-cell receptor T3 zeta chain|T-cell receptor zeta chain|T-cell surface glycoprotein CD3 zeta chain
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com