Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD3G (Human) Recombinant Protein (Q01)

  • Catalog # : H00000917-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD3G partial ORF ( NP_000064, 23 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000917-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 917
  • Gene Name:
  • CD3G
  • Gene Alias:
  • CD3-GAMMA,FLJ17620,FLJ17664,FLJ79544,FLJ94613,MGC138597,T3G
  • Gene Description:
  • CD3g molecule, gamma (CD3-TCR complex)
  • Gene Summary:
  • The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. [provided by RefSeq
  • Other Designations:
  • CD3G antigen, gamma polypeptide,CD3g antigen, gamma polypeptide (TiT3 complex),T-cell antigen receptor complex, gamma subunit of T3,T-cell receptor T3 gamma chain,T-cell surface glycoprotein CD3 gamma chain
  • RSS
  • YouTube
  • Linkedin
  • Facebook