CCNT2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CCNT2 partial ORF ( NP_490595, 264 a.a. - 370 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQLYSQKQET
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.51
Interspecies Antigen Sequence
Mouse (85); Rat (78)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCNT2
Entrez GeneID
905GeneBank Accession#
NM_058241Protein Accession#
NP_490595Gene Name
CCNT2
Gene Alias
FLJ90560, MGC134840
Gene Description
cyclin T2
Omim ID
603862Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin and its kinase partner CDK9 were found to be subunits of the transcription elongation factor p-TEFb. The p-TEFb complex containing this cyclin was reported to interact with, and act as a negative regulator of human immunodeficiency virus type 1 (HIV-1) Tat protein. Two alternatively spliced transcript variants, which encode distinct isoforms, have been described. [provided by RefSeq
Other Designations
SDS-stable vimentin-bound DNA fragment HEF42VIM22|cyclin T2a|cyclin T2b|subunit of positive elongation transcription factor b
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com