CCND2 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CCND2 protein.
Immunogen
CCND2 (NP_001750.1, 1 a.a. ~ 289 a.a) full-length human protein.
Sequence
MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCND2 expression in transfected 293T cell line (H00000894-T02) by CCND2 MaxPab polyclonal antibody.
Lane 1: CCND2 transfected lysate(33.10 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CCND2 transfected lysate using anti-CCND2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCND2 purified MaxPab mouse polyclonal antibody (B01P) (H00000894-B01P).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to CCND2 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — CCND2
Entrez GeneID
894GeneBank Accession#
NM_001759Protein Accession#
NP_001750.1Gene Name
CCND2
Gene Alias
KIAK0002, MGC102758
Gene Description
cyclin D2
Omim ID
123833Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. [provided by RefSeq
Other Designations
G1/S-specific cyclin D2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com