CCNB1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CCNB1 full-length ORF ( NP_114172.1, 1 a.a. - 433 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
74.7
Interspecies Antigen Sequence
Rat (85)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCNB1
Entrez GeneID
891GeneBank Accession#
NM_031966.2Protein Accession#
NP_114172.1Gene Name
CCNB1
Gene Alias
CCNB
Gene Description
cyclin B1
Omim ID
123836Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites. [provided by RefSeq
Other Designations
G2/mitotic-specific cyclin B1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A multiparametric serum marker panel as a complementary test to mammography for the diagnosis of node negative early-stage breast cancer and DCIS in young women.
Lacombe J, Mange A, Bougnoux AC, Prassas I, Solassol J.
Cancer Epidemiology, Biomarkers & Prevention 2014 Sep; 23(9):1834.
Application:ELISA, Human, Serum.
-
A multiparametric serum marker panel as a complementary test to mammography for the diagnosis of node negative early-stage breast cancer and DCIS in young women.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com