CCBL1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CCBL1 expression in transfected 293T cell line (H00000883-T02) by CCBL1 MaxPab polyclonal antibody.
Lane1:CCBL1 transfected lysate(27.5 KDa).
Lane2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CCBL1 protein.
Immunogen
CCBL1 (AAH21262.1, 1 a.a. ~ 250 a.a) full-length human protein.
Sequence
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIVSAAVLFGLGQPASLACGNGP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCBL1 expression in transfected 293T cell line (H00000883-T02) by CCBL1 MaxPab polyclonal antibody.
Lane1:CCBL1 transfected lysate(27.5 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — CCBL1
Entrez GeneID
883GeneBank Accession#
BC021262.2Protein Accession#
AAH21262.1Gene Name
CCBL1
Gene Alias
FLJ95217, GTK, KAT1, KATI, MGC29624
Gene Description
cysteine conjugate-beta lyase, cytoplasmic
Omim ID
600547Gene Ontology
HyperlinkGene Summary
This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022311|beta-lysase, kidney|cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase)|cytoplasmic cysteine conjugate-beta lyase|glutamine transaminase K|glutamine-phenylpyruvate aminotransferase|kyneure
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com