Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCBL1 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00000883-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CCBL1 protein.
  • Immunogen:
  • CCBL1 (AAH21262.1, 1 a.a. ~ 250 a.a) full-length human protein.
  • Sequence:
  • MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIVSAAVLFGLGQPASLACGNGP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CCBL1 expression in transfected 293T cell line (H00000883-T02) by CCBL1 MaxPab polyclonal antibody.

    Lane1:CCBL1 transfected lysate(27.5 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 883
  • Gene Name:
  • CCBL1
  • Gene Alias:
  • FLJ95217,GTK,KAT1,KATI,MGC29624
  • Gene Description:
  • cysteine conjugate-beta lyase, cytoplasmic
  • Gene Summary:
  • This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022311,beta-lysase, kidney,cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase),cytoplasmic cysteine conjugate-beta lyase,glutamine transaminase K,glutamine-phenylpyruvate aminotransferase,kyneure
  • RSS
  • YouTube
  • Linkedin
  • Facebook