Product Browser

Last updated: 2017/2/26
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CBR1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00000873-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CBR1 protein.
  • Immunogen:
  • CBR1 (NP_001748.1, 1 a.a. ~ 277 a.a) full-length human protein.
  • Sequence:
  • MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CBR1 MaxPab polyclonal antibody. Western Blot analysis of CBR1 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CBR1 MaxPab polyclonal antibody. Western Blot analysis of CBR1 expression in HeLa.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CBR1 expression in transfected 293T cell line (H00000873-T01) by CBR1 MaxPab polyclonal antibody.

    Lane 1: CBR1 transfected lysate(30.47 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 873
  • Gene Name:
  • CBR1
  • Gene Alias:
  • CBR,SDR21C1,hCBR1
  • Gene Description:
  • carbonyl reductase 1
  • Gene Summary:
  • Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q. [provided by RefSeq
  • Other Designations:
  • carbonyl reductase (NADPH) 1,prostaglandin 9-ketoreductase,prostaglandin-E(2) 9-reductase,short chain dehydrogenase/reductase family 21C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook