Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RUNX3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000864-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RUNX3 partial ORF ( NP_004341, 194 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000864-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 864
  • Gene Name:
  • RUNX3
  • Gene Alias:
  • AML2,CBFA3,FLJ34510,MGC16070,PEBP2aC
  • Gene Description:
  • runt-related transcription factor 3
  • Gene Summary:
  • This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000003370,OTTHUMP00000003371,PEA2 alpha C,PEBP2 alpha C,acute myeloid leukemia gene 2,core-binding factor, runt domain, alpha subunit 3,polyomavirus enhancer-binding protein 2 alpha C subunit,transcription factor AML2
  • RSS
  • YouTube
  • Linkedin
  • Facebook