Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RUNX1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000861-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RUNX1 partial ORF ( NP_001001890.1, 210 a.a. - 310 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.85
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000861-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 861
  • Gene Name:
  • RUNX1
  • Gene Alias:
  • AML1,AML1-EVI-1,AMLCR1,CBFA2,EVI-1,PEBP2aB
  • Gene Description:
  • runt-related transcription factor 1
  • Gene Summary:
  • Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • AML1-EVI-1 fusion protein,acute myeloid leukemia 1,aml1 oncogene,core-binding factor, runt domain, alpha subunit 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook