RUNX2 monoclonal antibody (M06), clone 3F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RUNX2.
Immunogen
RUNX2 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RUNX2 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RUNX2 on U-2 OS cell . [antibody concentration 10 ug/ml] -
Gene Info — RUNX2
Entrez GeneID
860GeneBank Accession#
NM_004348Protein Accession#
NP_004339Gene Name
RUNX2
Gene Alias
AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1
Gene Description
runt-related transcription factor 2
Gene Ontology
HyperlinkGene Summary
This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. [provided by RefSeq
Other Designations
CBF-alpha 1|OTTHUMP00000016533|SL3-3 enhancer factor 1 alpha A subunit|SL3/AKV core-binding factor alpha A subunit|acute myeloid leukemia 3 protein|core-binding factor, runt domain, alpha subunit 1|osteoblast-specific transcription factor 2|polyomavirus e
-
Interactome
-
Disease
-
Publication Reference
-
Granulation Tissue Eroding the Subchondral Bone Also Promotes New Bone Formation in Ankylosing Spondylitis.
Bleil J, Maier R, Hempfing A, Sieper J, Appel H, Syrbe U.
Arthritis & Rheumatology (Hoboken, N.J.) 2016 Oct; 68(10):2456.
Application:IF, IHC-P, Human, Human subchondral granulation tissues.
-
Spontaneous Differentiation of Human Mesenchymal Stem Cells on Poly-Lactic-Co-Glycolic Acid Nano-Fiber Scaffold.
Sonomoto K, Yamaoka K, Kaneko H, Yamagata K, Sakata K, Zhang X, Kondo M, Zenke Y, Sabanai K, Nakayamada S, Sakai A, Tanaka Y.
PLoS One 2016 Apr; 11(4):e0153231.
Application:IHC, Human, Mesenchymal stem cells.
-
Osteogenic, stem cell and molecular characterisation of the human induced membrane from extremity bone defects.
Gruber HE, Ode G, Hoelscher G, Ingram J, Bethea S, Bosse MJ.
Bone & Joint Research 2016 Apr; 5(4):106.
Application:IHC-P, Human, Human biomembrane tissues.
-
Aggregatibacter actinomycetemcomitans lipopolysaccharide regulates bone sialoprotein gene transcription.
Li X, Zhou L, Takai H, Sasaki Y, Mezawa M, Li Z, Wang Z, Yang L, Wang S, Matsumura H, Kaneko T, Yoshimura A, Ogata Y.
Journal of Cellular Biochemistry 2012 Sep; 113(9):2822.
Application:ChIP, Func, Rat, ROS 17/2.8 cells.
-
Transcription factor Runx2 is a regulator of epithelial-mesenchymal transition and invasion in thyroid carcinomas.
Niu DF, Kondo T, Nakazawa T, Oishi N, Kawasaki T, Mochizuki K, Yamane T, Katoh R.
Laboratory Investigation 2012 Aug; 92(8):1181.
Application:ICC, IF, IHC-P, WB-Ce, Human, Human malignant thyroid tissue including Follicular carcinoma, Papillary carcinoma, Undifferentiated carcinoma, 8305C, TPC-1, WRO cells.
-
cAMP and fibroblast growth factor 2 regulate bone sialoprotein gene expression in human prostate cancer cells.
Li Z, Sasaki Y, Mezawa M, Wang S, Li X, Yang L, Wang Z, Zhou L, Araki S, Matsumura H, Takai H, Ogata Y.
Gene 2011 Jan; 471(1-2):1.
Application:Func, Human, DU145 cells.
-
Effects of Inorganic Polyphosphate on Bone Sialoprotein Gene Expression.
Wang Z, Li X, Li Z, Yang L, Sasaki Y, Wang S, Zhou L, Araki S, Mezawa M, Takai H, Ogata Y.
Gene 2010 Mar; 452(2):79.
Application:ChIP, Rat, ROS 17/2.8 cells.
-
Granulation Tissue Eroding the Subchondral Bone Also Promotes New Bone Formation in Ankylosing Spondylitis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com