Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAV3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000859-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CAV3 partial ORF ( NP_001225, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.87
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000859-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • 1.
  • Overexpression of caveolin-1 in adult T-cell leukemia.
    Sawada S, Ishikawa C, Tanji H, Nakachi S, Senba M, Okudaira T, Uchihara JN, Taira N, Ohshiro K, Yamada Y, Tanaka Y, Uezato H, Ohshima K, Sasai K, Burgering BM, Duc Dodon M, Fujii M, Sunakawa H, Mori N.Blood. 2010 Mar 18;115(11):2220-30. Epub 2010 Jan 8.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 859
  • Gene Name:
  • CAV3
  • Gene Alias:
  • LGMD1C,LQT9,MGC126100,MGC126101,MGC126129,VIP-21,VIP21
  • Gene Description:
  • caveolin 3
  • Gene Summary:
  • This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq
  • Other Designations:
  • M-caveolin
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook