CAV3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CAV3 partial ORF ( NP_001225, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.87
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CAV3
Entrez GeneID
859GeneBank Accession#
NM_001234Protein Accession#
NP_001225Gene Name
CAV3
Gene Alias
LGMD1C, LQT9, MGC126100, MGC126101, MGC126129, VIP-21, VIP21
Gene Description
caveolin 3
Gene Ontology
HyperlinkGene Summary
This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq
Other Designations
M-caveolin
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Overexpression of caveolin-1 in adult T-cell leukemia.
Sawada S, Ishikawa C, Tanji H, Nakachi S, Senba M, Okudaira T, Uchihara JN, Taira N, Ohshiro K, Yamada Y, Tanaka Y, Uezato H, Ohshima K, Sasai K, Burgering BM, Duc Dodon M, Fujii M, Sunakawa H, Mori N.
Blood 2010 Mar; 115(11):2220.
Application：Func, Human, C5/MJ, SLB-1 cells.
-
Overexpression of caveolin-1 in adult T-cell leukemia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com