CAV1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CAV1 full-length ORF ( AAH09685, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.21
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CAV1
Entrez GeneID
857GeneBank Accession#
BC009685.1Protein Accession#
AAH09685Gene Name
CAV1
Gene Alias
BSCL3, CAV, CGL3, MSTP085, VIP21
Gene Description
caveolin 1, caveolae protein, 22kDa
Omim ID
601047Gene Ontology
HyperlinkGene Summary
The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene. [provided by RefSeq
Other Designations
OTTHUMP00000025031|caveolae protein, 22-kD|caveolin 1|caveolin 1 caveolae protein, 22kD|caveolin 1, alpha isoform|caveolin 1, beta isoform|caveolin-1 beta isoform protein|cell growth-inhibiting protein 32
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Caveolin-1, a binding protein of CD26, is essential for the anti-inflammatory effects of dipeptidyl peptidase-4 inhibitors on human and mouse macrophages.
Hiromura M, Nohtomi K, Mori Y, Kataoka H, Sugano M, Ohnuma K, Kuwata H, Hirano T.
Biochemical and Biophysical Research Communications 2018 Jan; 495(1):223.
Application:Func, PI, Recombinant protein.
-
A genetic polymorphism in the CAV1 gene associates with the development of bronchiolitis obliterans syndrome after lung transplantation.
Kastelijn EA, van Moorsel CH, Kazemier KM, Roothaan SM, Ruven HJ, Kwakkel-van Erp JM, van de Graaf EA, Zanen P, van Kessel DA, Grutters JC.
Fibrogenesis & Tissue Repair 2011 Nov; 4:24.
Application:ELISA, Human, Serum.
-
Temozolomide modifies caveolin-1 expression in experimental malignant gliomas in vitro and in vivo.
Bruyere C, Abeloos L, Lamoral-Theys D, Senetta R, Mathieu V, Le Mercier M, Kast RE, Cassoni P, Vandenbussche G, Kiss R, Lefranc F.
Transl Oncol 2011 Apr; 4:92.
Application:Treated, Recombinant protein.
-
Pathologic Caveolin-1 Regulation of PTEN in Idiopathic Pulmonary Fibrosis.
Xia H, Khalil W, Kahm J, Jessurun J, Kleidon J, Henke CA.
The American Journal of Pathology 2010 Jun; 176(6):2626.
Application:Func, PI, WB-Re, Recombinant protein.
-
Overexpression of caveolin-1 in adult T-cell leukemia.
Sawada S, Ishikawa C, Tanji H, Nakachi S, Senba M, Okudaira T, Uchihara JN, Taira N, Ohshiro K, Yamada Y, Tanaka Y, Uezato H, Ohshima K, Sasai K, Burgering BM, Duc Dodon M, Fujii M, Sunakawa H, Mori N.
Blood 2010 Mar; 115(11):2220.
Application:Func, Human, C5/MJ, SLB-1 cells.
-
Caveolin-1, a binding protein of CD26, is essential for the anti-inflammatory effects of dipeptidyl peptidase-4 inhibitors on human and mouse macrophages.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com