Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CASP7 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00000840-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CASP7 protein.
  • Immunogen:
  • CASP7 (NP_001218.1, 1 a.a. ~ 303 a.a) full-length human protein.
  • Sequence:
  • MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CASP7 expression in transfected 293T cell line (H00000840-T01) by CASP7 MaxPab polyclonal antibody.

    Lane 1: CASP7 transfected lysate(34.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of CASP7 transfected lysate using anti-CASP7 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CASP7 purified MaxPab mouse polyclonal antibody (B01P) (H00000840-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 840
  • Gene Name:
  • CASP7
  • Gene Alias:
  • CMH-1,ICE-LAP3,MCH3
  • Gene Description:
  • caspase 7, apoptosis-related cysteine peptidase
  • Gene Summary:
  • This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of this caspase is cleaved by caspase 3 and 10. It is activated upon cell death stimuli and induces apoptosis. Alternative splicing results in four transcript variants, encoding three distinct isoforms. [provided by RefSeq
  • Other Designations:
  • ICE-like apoptotic protease 3,Lice2 alpha/beta/gamma,OTTHUMP00000020510,OTTHUMP00000020511,OTTHUMP00000020512,OTTHUMP00000020514,apoptotic protease MCH-3,caspase 7,caspase 7 isoform delta,caspase 7, apoptosis-related cysteine protease
  • RSS
  • YouTube
  • Linkedin
  • Facebook