CASP6 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CASP6 protein.
Immunogen
CASP6 (NP_001217.2, 1 a.a. ~ 293 a.a) full-length human protein.
Sequence
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CASP6 MaxPab rabbit polyclonal antibody. Western Blot analysis of CASP6 expression in mouse lung.Western Blot (Transfected lysate)
Western Blot analysis of CASP6 expression in transfected 293T cell line (H00000839-T02) by CASP6 MaxPab polyclonal antibody.
Lane 1: CASP6 transfected lysate(33.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CASP6 and APP. HeLa cells were stained with anti-CASP6 rabbit purified polyclonal 1:1200 and anti-APP mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — CASP6
Entrez GeneID
839GeneBank Accession#
NM_001226Protein Accession#
NP_001217.2Gene Name
CASP6
Gene Alias
MCH2
Gene Description
caspase 6, apoptosis-related cysteine peptidase
Omim ID
601532Gene Ontology
HyperlinkGene Summary
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in two transcript variants that encode different isoforms. [provided by RefSeq
Other Designations
apoptotic protease MCH-2|caspase 6|caspase 6, apoptosis-related cysteine protease
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com