Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Disease

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CASP2 polyclonal antibody (A01)

  • Catalog # : H00000835-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CASP2.
  • Immunogen:
  • CASP2 (AAH02427, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000835-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CASP2 polyclonal antibody (A01), Lot # 051116JC01. Western Blot analysis of CASP2 expression in Daoy. Isoform 34.923 kDa
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 835
  • Gene Name:
  • CASP2
  • Gene Alias:
  • CASP-2,ICH-1L,ICH-1L/1S,ICH1,NEDD2
  • Gene Description:
  • caspase 2, apoptosis-related cysteine peptidase
  • Gene Summary:
  • This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The proteolytic cleavage of this protein is induced by a variety of apoptotic stimuli. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms. [provided by RefSeq
  • Other Designations:
  • ICH-1 protease,NEDD2 apoptosis regulatory,caspase 2,neural precursor cell expressed, developmentally down-regulated 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook