CAPZB monoclonal antibody (M03), clone 4H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CAPZB monoclonal antibody (M03), clone 4H8 Western Blot analysis of CAPZB expression in HeLa ( Cat # L013V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CAPZB is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.65 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CAPZB.
Immunogen
CAPZB (NP_004921, 192 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CAPZB monoclonal antibody (M03), clone 4H8 Western Blot analysis of CAPZB expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CAPZB is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — CAPZB
Entrez GeneID
832GeneBank Accession#
NM_004930Protein Accession#
NP_004921Gene Name
CAPZB
Gene Alias
CAPB, CAPPB, CAPZ, MGC104401, MGC129749, MGC129750
Gene Description
capping protein (actin filament) muscle Z-line, beta
Omim ID
601572Gene Ontology
HyperlinkGene Summary
CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq
Other Designations
Cap Z|F-actin capping protein beta subunit
-
Interactome
-
Disease
-
Publication Reference
-
The study of protein biomarkers to understand the biochemical processes underlying beef color development in young bulls.
Gagaoua M, Terlouw EMC, Picard B.
Meat Science 2017 Jul; 134:18.
Application：Dot, Bovine, Bovine muscle.
-
Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle.
Picard B, Gagaoua M, Micol D, Cassar-Malek I, Hocquette JF, Terlouw CE.
Journal of Agricultural and Food Chemistry 2014 Oct; 62(40):9808.
Application：Dot, Bovine, Bovine muscle.
-
Functional analysis of beef tenderness.
Guillemin N, Bonnet M, Jurie C, Picard B.
Journal of Proteomics 2011 Dec; 75(2):352.
Application：WB-Ti, Bovine, Bovine tenderness.
-
The study of protein biomarkers to understand the biochemical processes underlying beef color development in young bulls.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com