Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAST (Human) Recombinant Protein (Q01)

  • Catalog # : H00000831-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CAST partial ORF ( NP_001741.3, 582 a.a. - 669 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.42
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000831-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 831
  • Gene Name:
  • CAST
  • Gene Alias:
  • BS-17,MGC9402
  • Gene Description:
  • calpastatin
  • Gene Summary:
  • The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length natures of only some have been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000158519,OTTHUMP00000158520,calpain inhibitor,heart-type calpastatin,sperm BS-17 component
  • RSS
  • YouTube
  • Linkedin
  • Facebook