Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAPZA2 polyclonal antibody (A01)

  • Catalog # : H00000830-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CAPZA2.
  • Immunogen:
  • CAPZA2 (NP_006127, 111 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFW
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000830-A01
    Western Blot detection against Immunogen (32.6 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CAPZA2 polyclonal antibody (A01), Lot # 060525JCS1. Western Blot analysis of CAPZA2 expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 830
  • Gene Name:
  • CAPZA2
  • Gene Alias:
  • CAPPA2,CAPZ
  • Gene Description:
  • capping protein (actin filament) muscle Z-line, alpha 2
  • Gene Summary:
  • The protein encoded by this gene is a member of the F-actin capping protein alpha subunit family. It is the alpha subunit of the barbed-end actin binding protein Cap Z. By capping the barbed end of actin filaments, Cap Z regulates the growth of the actin filaments at the barbed end. [provided by RefSeq
  • Other Designations:
  • F-actin capping protein alpha-2 subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook