Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAPZA1 polyclonal antibody (A02)

  • Catalog # : H00000829-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CAPZA1.
  • Immunogen:
  • CAPZA1 (NP_006126, 82 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000829-A02
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CAPZA1 polyclonal antibody (A02), Lot # 060109JC01 Western Blot analysis of CAPZA1 expression in HL-60 ( Cat # L014V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 829
  • Gene Name:
  • CAPZA1
  • Gene Alias:
  • CAPPA1,CAPZ,CAZ1
  • Gene Description:
  • capping protein (actin filament) muscle Z-line, alpha 1
  • Gene Summary:
  • CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq
  • Other Designations:
  • Cap Z,F-actin capping protein alpha-1 subunit,OTTHUMP00000013512
  • RSS
  • YouTube
  • Linkedin
  • Facebook