Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAPNS1 monoclonal antibody (M01), clone 3C4

  • Catalog # : H00000826-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CAPNS1.
  • Immunogen:
  • CAPNS1 (AAH00592, 172 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000826-M01
    Western Blot detection against Immunogen (35.42 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CAPNS1 monoclonal antibody (M01), clone 3C4. Western Blot analysis of CAPNS1 expression in PC-12 ( Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CAPNS1 monoclonal antibody (M01), clone 3C4 Western Blot analysis of CAPNS1 expression in A-431 ( Cat # L015V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CAPNS1 expression in transfected 293T cell line by CAPNS1 monoclonal antibody (M01), clone 3C4.

    Lane 1: CAPNS1 transfected lysate(28.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to CAPNS1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged CAPNS1 is approximately 0.1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of CAPNS1 over-expressed 293 cell line, cotransfected with CAPNS1 Validated Chimera RNAi ( Cat # H00000826-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CAPNS1 monoclonal antibody (M01), clone 3C4 (Cat # H00000826-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 826
  • Gene Name:
  • CAPNS1
  • Gene Alias:
  • 30K,CALPAIN4,CANP,CANPS,CAPN4,CDPS
  • Gene Description:
  • calpain, small subunit 1
  • Gene Summary:
  • Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • calcium-activated neutral proteinase,calcium-dependent protease, small subunit,calpain 4, small subunit (30K),calpain, small polypeptide
  • RSS
  • YouTube
  • Linkedin
  • Facebook