CAPN3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CAPN3 partial ORF ( AAH03169.1, 210 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CAPN3
Entrez GeneID
825GeneBank Accession#
BC003169Protein Accession#
AAH03169.1Gene Name
CAPN3
Gene Alias
CANP3, CANPL3, LGMD2, LGMD2A, MGC10767, MGC11121, MGC14344, MGC4403, nCL-1, p94
Gene Description
calpain 3, (p94)
Gene Ontology
HyperlinkGene Summary
Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed. [provided by RefSeq
Other Designations
OTTHUMP00000161194|OTTHUMP00000161196|calpain 3|calpain p94, large [catalytic] subunit|calpain, large polypeptide L3|muscle-specific calcium-activated neutral protease 3 large subunit
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com