CANX monoclonal antibody (M08), clone 1D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CANX.
Immunogen
CANX (NP_001737.1, 504 a.a. ~ 592 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (80)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CANX on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CANX is approximately 1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CD3D and CANX. HeLa cells were stained with anti-CD3D rabbit purified polyclonal 1:1200 and anti-CANX mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to CANX on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CANX
Entrez GeneID
821GeneBank Accession#
NM_001746Protein Accession#
NP_001737.1Gene Name
CANX
Gene Alias
CNX, FLJ26570, IP90, P90
Gene Description
calnexin
Omim ID
114217Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq
Other Designations
major histocompatibility complex class I antigen-binding protein p88
-
Interactome
-
Pathway
-
Publication Reference
-
The SARS Coronavirus E Protein Interacts with PALS1 and Alters Tight Junction Formation and Epithelial Morphogenesis.
Teoh KT, Siu YL, Chan WL, Schluter MA, Liu CJ, Peiris JS, Bruzzone R, Margolis B, Nal B.
Molecular Biology of the Cell 2010 Nov; 21(22):3838.
Application:IF, Grivet, Vero E6 cells.
-
The SARS Coronavirus E Protein Interacts with PALS1 and Alters Tight Junction Formation and Epithelial Morphogenesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com