CALR monoclonal antibody (M01), clone 1G11-1A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CALR monoclonal antibody (M01), clone 1G11-1A9 Western Blot analysis of CALR expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of CALR expression in transfected 293T cell line by CALR monoclonal antibody (M01), clone 1G11-1A9.
Lane 1: CALR transfected lysate(48 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CALR on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CALR is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (71.61 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CALR.
Immunogen
CALR (AAH02500.1, 1 a.a. ~ 417 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (71.61 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CALR monoclonal antibody (M01), clone 1G11-1A9 Western Blot analysis of CALR expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CALR expression in transfected 293T cell line by CALR monoclonal antibody (M01), clone 1G11-1A9.
Lane 1: CALR transfected lysate(48 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CALR on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CALR is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — CALR
Entrez GeneID
811GeneBank Accession#
BC020493Protein Accession#
AAH02500.1Gene Name
CALR
Gene Alias
CRT, FLJ26680, RO, SSA, cC1qR
Gene Description
calreticulin
Omim ID
109091Gene Ontology
HyperlinkGene Summary
Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium. The amino terminus of calreticulin interacts with the DNA-binding domain of the glucocorticoid receptor and prevents the receptor from binding to its specific glucocorticoid response element. Calreticulin can inhibit the binding of androgen receptor to its hormone-responsive DNA element and can inhibit androgen receptor and retinoic acid receptor transcriptional activities in vivo, as well as retinoic acid-induced neuronal differentiation. Thus, calreticulin can act as an important modulator of the regulation of gene transcription by nuclear hormone receptors. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin but calreticulin is not a Ro/SS-A antigen. Earlier papers referred to calreticulin as an Ro/SS-A antigen but this was later disproven. Increased autoantibody titer against human calreticulin is found in infants with complete congenital heart block of both the IgG and IgM classes. [provided by RefSeq
Other Designations
Sicca syndrome antigen A (autoantigen Ro; calreticulin)|autoantigen Ro
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The angiogenesis inhibitor vasostatin is regulated by neutrophil elastase-dependent cleavage of calreticulin in AML patients.
Mans S, Banz Y, Mueller BU, Pabst T.
Blood 2012 Sep; 120(13):2690.
Application：ELISA, Human, Serum from patients with acute myeloid leukemia.
-
The angiogenesis inhibitor vasostatin is regulated by neutrophil elastase-dependent cleavage of calreticulin in AML patients.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com