CALD1 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CALD1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CALD1 expression in mouse intestine.
Western Blot (Transfected lysate)
Western Blot analysis of CALD1 expression in transfected 293T cell line (H00000800-T01) by CALD1 MaxPab polyclonal antibody.
Lane 1: CALD1 transfected lysate(62.7 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CALD1 transfected lysate using anti-CALD1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CALD1 purified MaxPab mouse polyclonal antibody (B01P) (H00000800-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CALD1 protein.
Immunogen
CALD1 (NP_004333.1, 1 a.a. ~ 538 a.a) full-length human protein.
Sequence
MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNAQNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CALD1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CALD1 expression in mouse intestine.Western Blot (Transfected lysate)
Western Blot analysis of CALD1 expression in transfected 293T cell line (H00000800-T01) by CALD1 MaxPab polyclonal antibody.
Lane 1: CALD1 transfected lysate(62.7 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CALD1 transfected lysate using anti-CALD1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CALD1 purified MaxPab mouse polyclonal antibody (B01P) (H00000800-B01P). -
Gene Info — CALD1
Entrez GeneID
800GeneBank Accession#
NM_004342.5Protein Accession#
NP_004333.1Gene Name
CALD1
Gene Alias
CDM, H-CAD, L-CAD, MGC21352, NAG22
Gene Description
caldesmon 1
Omim ID
114213Gene Ontology
HyperlinkGene Summary
This gene encodes a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids. This protein is a potent inhibitor of the actin-tropomyosin activated myosin MgATPase, and serves as a mediating factor for Ca(2+)-dependent inhibition of smooth muscle contraction. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com