Product Browser

Last updated: 2017/8/13
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CACNB1 monoclonal antibody (M01), clone 1G6

  • Catalog # : H00000782-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CACNB1.
  • Immunogen:
  • CACNB1 (NP_000714, 500 a.a. ~ 598 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • FDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000782-M01
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CACNB1 expression in transfected 293T cell line by CACNB1 monoclonal antibody (M01), clone 1G6.

    Lane 1: CACNB1 transfected lysate(65.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of CACNB1 over-expressed 293 cell line, cotransfected with CACNB1 Validated Chimera RNAi ( Cat # H00000782-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CACNB1 monoclonal antibody (M01), clone 1G6 (Cat # H00000782-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 782
  • Gene Name:
  • CACNB1
  • Gene Alias:
  • CAB1,CACNLB1,CCHLB1,MGC41896
  • Gene Description:
  • calcium channel, voltage-dependent, beta 1 subunit
  • Gene Summary:
  • The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164286,calcium channel, L type, beta 1 polypeptide,dihydropyridine-sensitive L-type, calcium channel beta-1 subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook