CACNA1E (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CACNA1E partial ORF ( NP_000712, 1901 a.a. - 1999 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQDIFQLACMDPADDGQFQERQSLVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CACNA1E
Entrez GeneID
777GeneBank Accession#
NM_000721Protein Accession#
NP_000712Gene Name
CACNA1E
Gene Alias
BII, CACH6, CACNL1A6, Cav2.3
Gene Description
calcium channel, voltage-dependent, R type, alpha 1E subunit
Omim ID
601013Gene Ontology
HyperlinkGene Summary
This gene encodes an alpha-1 subunit of a voltage-dependent calcium channel. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. The alpha-1 subunit consists of 24 transmembrane segments and forms the pore through which ions pass into the cell. The calcium channel consists of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. There are multiple isoforms of each of these proteins, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants of the gene described here have been observed but have not been thoroughly characterized. [provided by RefSeq
Other Designations
OTTHUMP00000042484|OTTHUMP00000042485|OTTHUMP00000042486|brain calcium channel II|calcium channel, R type, alpha-1 polypeptide, isoform 6|calcium channel, voltage-dependent, alpha 1E subunit|voltage-dependent calcium channel alpha 1E subunit|voltage-gated
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com