Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CACNA1E (Human) Recombinant Protein (Q01)

  • Catalog # : H00000777-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CACNA1E partial ORF ( NP_000712, 1901 a.a. - 1999 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQDIFQLACMDPADDGQFQERQSLVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000777-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 777
  • Gene Name:
  • CACNA1E
  • Gene Alias:
  • BII,CACH6,CACNL1A6,Cav2.3
  • Gene Description:
  • calcium channel, voltage-dependent, R type, alpha 1E subunit
  • Gene Summary:
  • This gene encodes an alpha-1 subunit of a voltage-dependent calcium channel. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. The alpha-1 subunit consists of 24 transmembrane segments and forms the pore through which ions pass into the cell. The calcium channel consists of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. There are multiple isoforms of each of these proteins, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants of the gene described here have been observed but have not been thoroughly characterized. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000042484,OTTHUMP00000042485,OTTHUMP00000042486,brain calcium channel II,calcium channel, R type, alpha-1 polypeptide, isoform 6,calcium channel, voltage-dependent, alpha 1E subunit,voltage-dependent calcium channel alpha 1E subunit,voltage-gated
  • RSS
  • YouTube
  • Linkedin
  • Facebook