Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CACNA1C polyclonal antibody (A01)

  • Catalog # : H00000775-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CACNA1C.
  • Immunogen:
  • CACNA1C (NP_000710, 2039 a.a. ~ 2138 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000775-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CACNA1C polyclonal antibody (A01). Western Blot analysis of CACNA1C expression in rat testis.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 775
  • Gene Name:
  • CACNA1C
  • Gene Alias:
  • CACH2,CACN2,CACNL1A1,CCHL1A1,CaV1.2,MGC120730,TS
  • Gene Description:
  • calcium channel, voltage-dependent, L type, alpha 1C subunit
  • Gene Summary:
  • This gene encodes an alpha-1 subunit of a voltage-dependent calcium channel. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. The alpha-1 subunit consists of 24 transmembrane segments and forms the pore through which ions pass into the cell. The calcium channel consists of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. There are multiple isoforms of each of these proteins, either encoded by different genes or the result of alternative splicing of transcripts. The protein encoded by this gene binds to and is inhibited by dihydropyridine. Alternative splicing results in many transcript variants encoding different proteins. [provided by RefSeq
  • Other Designations:
  • DHPR, alpha-1 subunit,calcium channel, L type, alpha 1 polypeptide, isoform 1, cardic muscle,calcium channel, cardic dihydropyridine-sensitive, alpha-1 subunit,voltage-gated L-type calcium channel Cav1.2 alpha 1 subunit, splice variant 10*,voltage-gated c
  • RSS
  • YouTube
  • Linkedin
  • Facebook