CA12 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CA12 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA12 expression in MCF-7.
Western Blot (Transfected lysate)
Western Blot analysis of CA12 expression in transfected 293T cell line (H00000771-T01) by CA12 MaxPab polyclonal antibody.
Lane 1: CA12 transfected lysate(39.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CA12 protein.
Immunogen
CA12 (NP_001209.1, 1 a.a. ~ 354 a.a) full-length human protein.
Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CA12 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA12 expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of CA12 expression in transfected 293T cell line (H00000771-T01) by CA12 MaxPab polyclonal antibody.
Lane 1: CA12 transfected lysate(39.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CA12
Entrez GeneID
771GeneBank Accession#
NM_001218.3Protein Accession#
NP_001209.1Gene Name
CA12
Gene Alias
CAXII, FLJ20151, HsT18816
Gene Description
carbonic anhydrase XII
Omim ID
603263Gene Ontology
HyperlinkGene Summary
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
carbonic dehydratase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com