CA4 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CA4 MaxPab polyclonal antibody. Western Blot analysis of CA4 expression in A-431.
Western Blot (Transfected lysate)
Western Blot analysis of CA4 expression in transfected 293T cell line (H00000762-T01) by CA4 MaxPab polyclonal antibody.
Lane 1: CA4 transfected lysate(34.32 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CA4 protein.
Immunogen
CA4 (NP_000708.1, 1 a.a. ~ 312 a.a) full-length human protein.
Sequence
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (55); Rat (58)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CA4 MaxPab polyclonal antibody. Western Blot analysis of CA4 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of CA4 expression in transfected 293T cell line (H00000762-T01) by CA4 MaxPab polyclonal antibody.
Lane 1: CA4 transfected lysate(34.32 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CA4
Entrez GeneID
762GeneBank Accession#
NM_000717.2Protein Accession#
NP_000708.1Gene Name
CA4
Gene Alias
CAIV, Car4, RP17
Gene Description
carbonic anhydrase IV
Gene Ontology
HyperlinkGene Summary
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Its exact function is not known; however, it may have a role in inherited renal abnormalities of bicarbonate transport. [provided by RefSeq
Other Designations
carbonic dehydratase|retinitis pigmentosa 17 (autosomal dominant)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Rest interval duration does not influence adaptations in acid/base transport proteins following 10 weeks of sprint-interval training in active women.
McGinley C, Bishop DJ.
American Journal of Physiology. Regulatory, Integrative and Comparative Physiology 2017 May; 312(5):R702.
Application：WB, Human, Human muscle biopsies.
-
Rest interval duration does not influence adaptations in acid/base transport proteins following 10 weeks of sprint-interval training in active women.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com