CA3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CA3 protein.
Immunogen
CA3 (NP_005172.1, 1 a.a. ~ 260 a.a) full-length human protein.
Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CA3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA3 expression in mouse lung.Western Blot (Tissue lysate)
CA3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA3 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of CA3 expression in transfected 293T cell line (H00000761-T02) by CA3 MaxPab polyclonal antibody.
Lane 1: CA3 transfected lysate(29.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CA3
Entrez GeneID
761GeneBank Accession#
NM_005181Protein Accession#
NP_005172.1Gene Name
CA3
Gene Alias
CAIII, Car3
Gene Description
carbonic anhydrase III, muscle specific
Omim ID
114750Gene Ontology
HyperlinkGene Summary
Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns. [provided by RefSeq
Other Designations
carbonic anhydrase III
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com