MPPED1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MPPED1 MaxPab polyclonal antibody. Western Blot analysis of MPPED1 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of MPPED1 expression in transfected 293T cell line (H00000758-T02) by MPPED1 MaxPab polyclonal antibody.
Lane 1: MPPED1 transfected lysate(35.86 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to MPPED1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MPPED1 protein.
Immunogen
MPPED1 (NP_001576.3, 1 a.a. ~ 326 a.a) full-length human protein.
Sequence
MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MPPED1 MaxPab polyclonal antibody. Western Blot analysis of MPPED1 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of MPPED1 expression in transfected 293T cell line (H00000758-T02) by MPPED1 MaxPab polyclonal antibody.
Lane 1: MPPED1 transfected lysate(35.86 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to MPPED1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] -
Gene Info — MPPED1
Entrez GeneID
758GeneBank Accession#
NM_001585.2Protein Accession#
NP_001576.3Gene Name
MPPED1
Gene Alias
239AB, C22orf1, FAM1A, MGC88045
Gene Description
metallophosphoesterase domain containing 1
Omim ID
602112Gene Ontology
HyperlinkOther Designations
OTTHUMP00000028881|adult brain protein 239
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com