Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTTG1IP (Human) Recombinant Protein (P01)

  • Catalog # : H00000754-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PTTG1IP full-length ORF ( AAH20983, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.54
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000754-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 754
  • Gene Name:
  • PTTG1IP
  • Gene Alias:
  • C21orf1,C21orf3,PBF
  • Gene Description:
  • pituitary tumor-transforming 1 interacting protein
  • Gene Summary:
  • The encoded protein, which directly binds to pituitary tumor-transforming gene 1 protein (PTTG1), facilitates the nuclear translocation of PTTG1 and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1. The gene product localizes to both the cytoplasm and nucleus. Its NLS is required for its own nuclear localization, the nuclear localization of PTTG1, and its interaction with PTTG1. [provided by RefSeq
  • Other Designations:
  • PTTG-binding factor,pituitary tumor-transforming gene 1 protein-interacting protein,pituitary tumor-transforming gene protein-binding factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook