PTTG1IP monoclonal antibody (M04), clone 4C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PTTG1IP expression in transfected 293T cell line by PTTG1IP monoclonal antibody (M04), clone 4C11.
Lane 1: PTTG1IP transfected lysate(20.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PTTG1IP is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PTTG1IP on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (45.54 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PTTG1IP.
Immunogen
PTTG1IP (AAH20983, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (78)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.54 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PTTG1IP expression in transfected 293T cell line by PTTG1IP monoclonal antibody (M04), clone 4C11.
Lane 1: PTTG1IP transfected lysate(20.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PTTG1IP is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PTTG1IP on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PTTG1IP
Entrez GeneID
754GeneBank Accession#
BC020983Protein Accession#
AAH20983Gene Name
PTTG1IP
Gene Alias
C21orf1, C21orf3, PBF
Gene Description
pituitary tumor-transforming 1 interacting protein
Omim ID
603784Gene Ontology
HyperlinkGene Summary
The encoded protein, which directly binds to pituitary tumor-transforming gene 1 protein (PTTG1), facilitates the nuclear translocation of PTTG1 and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1. The gene product localizes to both the cytoplasm and nucleus. Its NLS is required for its own nuclear localization, the nuclear localization of PTTG1, and its interaction with PTTG1. [provided by RefSeq
Other Designations
PTTG-binding factor|pituitary tumor-transforming gene 1 protein-interacting protein|pituitary tumor-transforming gene protein-binding factor
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com