Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTTG1IP purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00000754-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PTTG1IP protein.
  • Immunogen:
  • PTTG1IP (AAH20983, 1 a.a. ~ 180 a.a) full-length human protein.
  • Sequence:
  • MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PTTG1IP expression in transfected 293T cell line (H00000754-T01) by PTTG1IP MaxPab polyclonal antibody.

    Lane 1: PTTG1IP transfected lysate(19.91 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 754
  • Gene Name:
  • PTTG1IP
  • Gene Alias:
  • C21orf1,C21orf3,PBF
  • Gene Description:
  • pituitary tumor-transforming 1 interacting protein
  • Gene Summary:
  • The encoded protein, which directly binds to pituitary tumor-transforming gene 1 protein (PTTG1), facilitates the nuclear translocation of PTTG1 and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1. The gene product localizes to both the cytoplasm and nucleus. Its NLS is required for its own nuclear localization, the nuclear localization of PTTG1, and its interaction with PTTG1. [provided by RefSeq
  • Other Designations:
  • PTTG-binding factor,pituitary tumor-transforming gene 1 protein-interacting protein,pituitary tumor-transforming gene protein-binding factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook