Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MPPED2 monoclonal antibody (M01A), clone 2G1-1B7

  • Catalog # : H00000744-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant MPPED2.
  • Immunogen:
  • MPPED2 (AAH31582, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000744-M01A
    Western Blot detection against Immunogen (58.08 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MPPED2 expression in transfected 293T cell line by C11orf8 monoclonal antibody (M01A), clone 2G1-1B7.

    Lane 1: MPPED2 transfected lysate(33.81 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 744
  • Gene Name:
  • MPPED2
  • Gene Alias:
  • 239FB,C11orf8,D11S302E,FAM1B,Hs.46638,dJ1024C24.1,dJ873F21.1
  • Gene Description:
  • metallophosphoesterase domain containing 2
  • Gene Summary:
  • This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq
  • Other Designations:
  • dJ1024C24.1 (C11ORF8 protein),dJ873F21.1 (brain protein 239)
  • RSS
  • YouTube
  • Linkedin
  • Facebook