Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C1QC MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00000714-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human C1QC protein.
  • Immunogen:
  • C1QC (NP_758957.2, 1 a.a. ~ 245 a.a) full-length human protein.
  • Sequence:
  • MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • C1QC MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QC expression in human spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of C1QC expression in transfected 293T cell line (H00000714-T02) by C1QC MaxPab polyclonal antibody.

    Lane 1: C1QC transfected lysate(25.80 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of C1QC transfected lysate using anti-C1QC MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with C1QC purified MaxPab mouse polyclonal antibody (B01P) (H00000714-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 714
  • Gene Name:
  • C1QC
  • Gene Alias:
  • C1Q-C,C1QG,FLJ27103
  • Gene Description:
  • complement component 1, q subcomponent, C chain
  • Gene Summary:
  • This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000002932,OTTHUMP00000002933,OTTHUMP00000037922,complement C1q subcomponent subunit C,complement component 1, q subcomponent, gamma polypeptide
  • RSS
  • YouTube
  • Linkedin
  • Facebook