C1QC MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human C1QC protein.
Immunogen
C1QC (NP_758957.2, 1 a.a. ~ 245 a.a) full-length human protein.
Sequence
MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
C1QC MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QC expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of C1QC expression in transfected 293T cell line (H00000714-T02) by C1QC MaxPab polyclonal antibody.
Lane 1: C1QC transfected lysate(25.80 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of C1QC transfected lysate using anti-C1QC MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with C1QC purified MaxPab mouse polyclonal antibody (B01P) (H00000714-B01P). -
Gene Info — C1QC
Entrez GeneID
714GeneBank Accession#
NM_172369Protein Accession#
NP_758957.2Gene Name
C1QC
Gene Alias
C1Q-C, C1QG, FLJ27103
Gene Description
complement component 1, q subcomponent, C chain
Omim ID
120575Gene Ontology
HyperlinkGene Summary
This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000002932|OTTHUMP00000002933|OTTHUMP00000037922|complement C1q subcomponent subunit C|complement component 1, q subcomponent, gamma polypeptide
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com