C1QBP purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
C1QBP MaxPab polyclonal antibody. Western Blot analysis of C1QBP expression in human liver.
Western Blot (Cell lysate)
C1QBP MaxPab polyclonal antibody. Western Blot analysis of C1QBP expression in HL-60.
Western Blot (Transfected lysate)
Western Blot analysis of C1QBP expression in transfected 293T cell line (H00000708-T02) by C1QBP MaxPab polyclonal antibody.
Lane 1: C1QBP transfected lysate(31.02 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to C1QBP on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human C1QBP protein.
Immunogen
C1QBP (NP_001203.1, 1 a.a. ~ 282 a.a) full-length human protein.
Sequence
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
C1QBP MaxPab polyclonal antibody. Western Blot analysis of C1QBP expression in human liver.Western Blot (Cell lysate)
C1QBP MaxPab polyclonal antibody. Western Blot analysis of C1QBP expression in HL-60.Western Blot (Transfected lysate)
Western Blot analysis of C1QBP expression in transfected 293T cell line (H00000708-T02) by C1QBP MaxPab polyclonal antibody.
Lane 1: C1QBP transfected lysate(31.02 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to C1QBP on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — C1QBP
Entrez GeneID
708GeneBank Accession#
NM_001212Protein Accession#
NP_001203.1Gene Name
C1QBP
Gene Alias
GC1QBP, HABP1, SF2p32, gC1Q-R, gC1qR, p32
Gene Description
complement component 1, q subcomponent binding protein
Omim ID
601269Gene Ontology
HyperlinkGene Summary
The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq
Other Designations
C1q globular domain-binding protein|hyaluronan-binding protein 1|splicing factor SF2-associated protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com