Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSPO purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000706-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human TSPO protein.
  • Immunogen:
  • TSPO (AAH01110.1, 1 a.a. ~ 169 a.a) full-length human protein.
  • Sequence:
  • MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TSPO expression in transfected 293T cell line (H00000706-T01) by TSPO MaxPab polyclonal antibody.

    Lane 1: TSPO transfected lysate(18.80 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 706
  • Gene Name:
  • TSPO
  • Gene Alias:
  • BZRP,DBI,IBP,MBR,PBR,PKBS,PTBR,mDRC,pk18
  • Gene Description:
  • translocator protein (18kDa)
  • Gene Summary:
  • Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028891,benzodiazepine peripheral binding site,mitochondrial benzodiazepine receptor,peripheral benzodiazepine receptor,peripheral-type benzodiazepine receptor,translocator protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook