BUB1 monoclonal antibody (M02J), clone 2F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of BUB1 expression in transfected 293T cell line by BUB1 monoclonal antibody (M02J), clone 2F9.
Lane 1: BUB1 transfected lysate (Predicted MW: 122.4 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of BUB1 transfected lysate using anti-BUB1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BUB1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BUB1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (39.93 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BUB1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
BUB1 (AAH28201, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQA
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.93 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BUB1 expression in transfected 293T cell line by BUB1 monoclonal antibody (M02J), clone 2F9.
Lane 1: BUB1 transfected lysate (Predicted MW: 122.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of BUB1 transfected lysate using anti-BUB1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BUB1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BUB1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — BUB1
Entrez GeneID
699GeneBank Accession#
BC028201Protein Accession#
AAH28201Gene Name
BUB1
Gene Alias
BUB1A, BUB1L, hBUB1
Gene Description
budding uninhibited by benzimidazoles 1 homolog (yeast)
Omim ID
602452Gene Ontology
HyperlinkGene Summary
This gene encodes a kinase involved in spindle checkpoint function. The kinase functions in part by phosphorylating a member of the miotic checkpoint complex and activating the spindle checkpoint. Mutations in this gene have been associated with aneuploidy and several forms of cancer. [provided by RefSeq
Other Designations
BUB1 budding uninhibited by benzimidazoles 1 homolog|budding uninhibited by benzimidazoles 1|mitotic spindle checkpoint kinase|putative serine/threonine-protein kinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com