Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BTN1A1 (Human) Recombinant Protein (Q02)

  • Catalog # : H00000696-Q02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BTN1A1 partial ORF ( NP_001723.2, 482 a.a. - 526 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 30.58
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000696-Q02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 696
  • Gene Name:
  • BTN1A1
  • Gene Alias:
  • BT,BTN
  • Gene Description:
  • butyrophilin, subfamily 1, member A1
  • Gene Summary:
  • Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017981,bK14H9.2 (butyrophilin, subfamily 1, member A1)
  • RSS
  • YouTube
  • Linkedin
  • Facebook