BST1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of BST1 expression in transfected 293T cell line (H00000683-T01) by BST1 MaxPab polyclonal antibody.
Lane 1: BST1 transfected lysate(35.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human BST1 protein.
Immunogen
BST1 (AAH12095.1, 1 a.a. ~ 318 a.a) full-length human protein.
Sequence
MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BST1 expression in transfected 293T cell line (H00000683-T01) by BST1 MaxPab polyclonal antibody.
Lane 1: BST1 transfected lysate(35.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — BST1
Entrez GeneID
683GeneBank Accession#
BC012095.1Protein Accession#
AAH12095.1Gene Name
BST1
Gene Alias
CD157
Gene Description
bone marrow stromal cell antigen 1
Omim ID
600387Gene Ontology
HyperlinkGene Summary
Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The CD157-integrin partnership controls transendothelial migration and adhesion of human monocytes.
Lo Buono N, Parrotta R, Morone S, Bovino P, Nacci G, Ortolan E, Horenstein AL, Inzhutova A, Ferrero E, Funaro A.
J Biol Chem 2011 Apr; 286:18681.
Application：IP, IP-WB, WB-Ce, Human, THP-1 cells.
-
The CD157-integrin partnership controls transendothelial migration and adhesion of human monocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com