ZFP36L1 monoclonal antibody (M02), clone 1A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZFP36L1.
Immunogen
ZFP36L1 (NP_004917, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZFP36L1 expression in transfected 293T cell line by ZFP36L1 monoclonal antibody (M02), clone 1A3.
Lane 1: ZFP36L1 transfected lysate(36.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZFP36L1 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ZFP36L1 over-expressed 293 cell line, cotransfected with ZFP36L1 Validated Chimera RNAi ( Cat # H00000677-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZFP36L1 monoclonal antibody (M02), clone 1A3 (Cat # H00000677-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — ZFP36L1
Entrez GeneID
677GeneBank Accession#
NM_004926Protein Accession#
NP_004917Gene Name
ZFP36L1
Gene Alias
BRF1, Berg36, ERF-1, ERF1, RNF162B, TIS11B, cMG1
Gene Description
zinc finger protein 36, C3H type-like 1
Omim ID
601064Gene Ontology
HyperlinkGene Summary
This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. [provided by RefSeq
Other Designations
EGF-response factor 1|butyrate response factor 1|early response factor Berg36|zinc finger protein, C3H type, 36-like 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com