BPHL (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BPHL full-length ORF ( NP_004323.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
57.5
Interspecies Antigen Sequence
Mouse (86); Rat (86)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BPHL
Entrez GeneID
670GeneBank Accession#
NM_004332.1Protein Accession#
NP_004323.1Gene Name
BPHL
Gene Alias
Bph-rp, MCNAA, MGC125930, MGC41865
Gene Description
biphenyl hydrolase-like (serine hydrolase)
Omim ID
603156Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described
Other Designations
OTTHUMP00000015959|biphenyl hydrolase-like|biphenyl hydrolase-like (serine hydrolase; breast epithelial mucin-associated antigen)|breast epithelial mucin-associated antigen|valacyclovirase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com